PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0422s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 661aa    MW: 73351.4 Da    PI: 6.0253
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0422s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.73.8e-22123223198
                             EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                             f+k+lt sd++++g +++ +++a+++       +++    ++l+  d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD +
  SapurV1A.0422s0040.1.p 123 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVAADLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAF 207
                             99****************************964333..4459********************************************* PP

                             EEEE-SSSEE..EEEEE- CS
                      B3  81 vFkldgrsefelvvkvfr 98 
                             +F   + +++el+v+v+r
  SapurV1A.0422s0040.1.p 208 IFL--RGENGELRVGVRR 223
                             ***..449999*****97 PP

2Auxin_resp1095e-36249331183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha++t++ F+v+Y+Pr+s+seF+v+++k+ +a ++ +svGmRfkm+fe+e+++err+sGt+vgv d  ++ W +S+WrsLk
  SapurV1A.0422s0040.1.p 249 ASHAIATGTLFSVFYKPRTSRSEFIVNLNKYIEAQNHTLSVGMRFKMRFEGEEVPERRFSGTIVGVGDNISSGWADSEWRSLK 331
                             789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.07E-43113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-40120238IPR015300DNA-binding pseudobarrel domain
CDDcd100173.01E-20121223No hitNo description
PfamPF023623.1E-20123223IPR003340B3 DNA binding domain
PROSITE profilePS5086311.18123225IPR003340B3 DNA binding domain
SMARTSM010191.6E-20123225IPR003340B3 DNA binding domain
PfamPF065072.3E-34249331IPR010525Auxin response factor
PfamPF023091.4E-6531570IPR033389AUX/IAA domain
PROSITE profilePS5174526.338534627IPR000270PB1 domain
SuperFamilySSF542777.75E-10537611No hitNo description
PfamPF023092.0E-6575624IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MNHTSGGNQH PGGCNDALYK ELWHACAGPL VTLPCEGERV YYFPQGHMEQ LEASMHQGME  60
QQMPSFNLPS KILCKVVNVQ CRAEPETDEV YAQITLLPEP AQSEVTSPDP PLPEPERCTV  120
HSFCKTLTAS DTSTHGGFSV LRRHADDCLP PLDMSQQPPW QELVAADLHG NEWHFRHIFR  180
GQPRRHLLTT GWSVFVSSKK LVAGDAFIFL RGENGELRVG VRRLMRQQTT MPSSVISSQS  240
MHLGVLATAS HAIATGTLFS VFYKPRTSRS EFIVNLNKYI EAQNHTLSVG MRFKMRFEGE  300
EVPERRFSGT IVGVGDNISS GWADSEWRSL KVQWDEPSSI LRPEKVSPWD LEPLVATNPS  360
NPQPVQRNKR PRPSVLPSPT TDISALGMWK PSVEYSAFSY GESQRGRDPY PSPNFSTTAK  420
ANSVGFCGNS QVTSVSPNSM HWPNRVESVT DSFAPVVNKD LGERRQGTGI GYRLFGIQLI  480
DNFNAEGTSP VVTVSGTVGS DRPVVSLEAE SDQHSEPEKS CLRSPQELQS RQIRSCTKVH  540
MQGVAVGRAV DLTQFECYED LLRKLEEMFD IEGELNGSTK KWQVVYTDNE DDMMKVGDDP  600
WHEFCSMVKK IFIYASEEVK RLSPKIKLSS DEEVKGGSAN NNADAAVNTE DRSSVVGPGC  660
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.023545355Auxin response factor 1
4ldw_A0.023545355Auxin response factor 1
4ldw_B0.023545355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1368372KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1130350.0KM113035.1 Populus davidiana x Populus alba var. pyramidalis auxin response factor 1 family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385188.10.0auxin response factor 1 family protein
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLU5GHK90.0U5GHK9_POPTR; Auxin response factor
STRINGPOPTR_0003s00890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68022638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1